PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00040793_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 135aa    MW: 14998.6 Da    PI: 4.398
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00040793_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB80.71.9e-251485097
                             NF-YB 50 asdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                                      asdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re+egek
  FANhyb_icon00040793_a.1.g00001.1  1 ASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFREMEGEK 48
                                      89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-24178IPR009072Histone-fold
SuperFamilySSF471131.13E-17159IPR009072Histone-fold
PRINTSPR006152.5E-11523No hitNo description
PRINTSPR006152.5E-112442No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
ASDKCQREKR KTINGDDLLW AMTTLGFEEY VEPLKVYLQR FREMEGEKSS MAARDKDSSG  60
GVVGFEGGGE EQEQEEGESI GSSSRSRDTC TAAGGFIRWV LVGLGLERVG LGPTWVDPDD  120
EKKQNRLYEL LSLNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-181435294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-181435294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A2e-181435193NF-YB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPOPTR_0001s37620.15e-30(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-31nuclear factor Y, subunit B3